By: Laura Mildon
BPC-157 and TB-500 are frequently discussed together as a two-component peptide blend. The pairing is also informally called the “Wolverine stack.” That nickname is a marketplace and community label, not a scientific description or evidence of a particular biological result. The meaningful starting point is the identity of each ingredient and the research that actually tested it.
The two names appear in literature on experimental tissue biology, analytical chemistry, and metabolism. Those separate research histories can suggest questions about combinations, but they do not establish the effects of a finished blend. A small human report involving BPC-157 and a substance described as thymosin beta-4 also requires careful interpretation.
A blend physically combines ingredients in one preparation. “Stack” is informal vernacular for a combination of multiple peptides; it is commonly used when they are mixed together, but can also describe combinations whose components remain separately supplied. Neither term defines a universal formulation or demonstrates compatibility or synergy.
For this pairing, the TB-500 identity is especially important. FDA’s chemical assessment describes TB-500 as the acetylated seven-residue fragment Ac-LKKTETQ. Some commercial descriptions use TB-500 terminology for full-length thymosin beta-4, which contains 43 amino acid residues. These different materials should not inherit each other’s research findings.
| Property | Description |
| BPC 157 class | Synthetic pentadecapeptide containing 15 amino acid residues |
| BPC 157 sequence | H-GEPPPGKPADDAGLV-OH |
| BPC 157 parent formula | C₆₂H₉₈N₁₆O₂₂ |
| BPC 157 molecular weight | Approximately 1419.5 g/mol |
| TB 500 form discussed here | N-acetylated heptapeptide containing 7 amino acid residues |
| TB 500 sequence | Ac-LKKTETQ-OH |
| TB 500 parent formula | C₃₈H₆₈N₁₀O₁₄ |
| TB 500 molecular weight | Approximately 889.0 g/mol |
Ac identifies the N-terminal acetyl group, and the final OH identifies a free carboxylic acid. The parent formulas exclude associated salt counterions and water. These specifications describe individual molecules; there is no single molecular formula or molecular weight that defines the blend name.
PubChem BPC 157 identity and structural diagram
FDA TB 500 identity and chemical characterization
Thymosin beta-4 was isolated from calf thymus and its complete sequence published by Low and colleagues in 1981. That is a milestone for the full-length parent peptide. It should not be presented as the discovery date of the seven-residue TB-500 fragment.
Complete sequence of thymosin beta 4 published in 1981
In 2012, Esposito and colleagues identified Ac-LKKTETQ in a preparation called TB-500 and synthesized a reference peptide for characterization. This is a documented chemical identification milestone, rather than proof that every later product bearing the name contains the same substance.
Identification and synthesis of the acetylated TB 500 fragment in 2012
BPC-157 has its own experimental literature. A 2008 study examined early functional and inflammatory measurements after tendon-to-bone transection in rats, while a 2014 study investigated signaling in isolated rat tendon fibroblasts. These are milestones in the component’s research, not studies of this two-peptide blend.
BPC 157 rat tendon to bone study published in 2008
Fibroblasts help produce and maintain the extracellular matrix, the structural material surrounding cells. Cell migration, collagen synthesis, vessel formation, and inflammatory signaling are different processes that researchers can measure. A change in one does not establish restoration of an injured tissue’s strength or function.
Thymosin beta-4 research includes actin, a protein involved in cell structure and movement. A short fragment may preserve a region of interest while lacking other parts of the full-length molecule. Sequence similarity provides a reason to investigate the fragment; it does not establish identical activity, metabolism, or outcomes.
Different research topics for two ingredients can motivate a combination hypothesis. Demonstrating that hypothesis requires testing the specified ingredients together, with suitable comparisons. A description such as “complementary mechanisms” does not show that the combination has been tested or that one ingredient improves the other’s effects.
A useful study would distinguish the complete blend from each component alone and report a defined endpoint. The identity, formulation, and proportion tested would remain part of the result. Findings from one mixture cannot automatically authenticate a different preparation.
An accurate illustration would display the verified BPC-157 structure alongside the specified TB-500 structure. A formula counts atoms, while molecular connections, terminal groups, and stereochemistry define the substance. Joining the two structures into a single chain would depict a new chemical entity rather than this mixture.
PubChem structural record for the acetylated TB 500 fragment
Krivic and colleagues examined BPC-157 in a rat Achilles tendon-to-bone transection model and reported changes in early functional, inflammatory, and vascular measurements. The experiment addressed an induced injury in rats over a short observation period. It does not establish human clinical effectiveness, and it did not test BPC-157 combined with TB-500.
Modulation of early functional recovery after tendon to bone transection 2008
Chang and colleagues studied fibroblasts isolated from rat Achilles tendons. They reported increased growth hormone receptor expression after BPC-157 exposure and examined responses to growth hormone. This is a mechanistic cell study. Receptor expression and cell proliferation are not equivalent to clinical repair or proof of combination synergy.
BPC 157 and growth hormone receptor expression in tendon fibroblasts 2014
Rahaman and colleagues developed methods to quantify TB-500 and breakdown products and compared their activity in a fibroblast wound-closure assay. Only the metabolite Ac-LKKTE showed significant activity compared with the control in that assay. The parent peptide did not show that significant effect. A scratch closing in a cell layer does not reproduce all features of tissue repair in a living organism.
This result concerns the specified fragment and its metabolites. It should not be generalized to full-length thymosin beta-4 or used to assert how a BPC-157 blend behaves.
TB 500 metabolite quantification and cell screening research 2024
Lee and Padgett published a retrospective report concerning knee pain. It described outcomes for 16 people, including four who received BPC-157 with a material identified as thymosin beta-4. The other participants received BPC-157 without that second peptide. The report described subjective improvement, but there was no randomized allocation or placebo control.
Four combination recipients are too few to establish that adding the second peptide improves outcomes. Retrospective selection, differing knee conditions, subjective reports, and lack of a controlled comparison also limit interpretation. The designation thymosin beta-4 does not establish that the seven-residue TB-500 fragment was tested.
Lee and Padgett retrospective knee pain report 2021
The targeted literature search for this article did not identify a controlled clinical trial establishing the effectiveness of a fully characterized BPC-157 and Ac-LKKTETQ blend. The 2021 report is relevant but does not resolve that question. Ingredient studies and reports involving a differently identified molecule should retain their actual scope.
Synergy means exceeding a defined expectation based on individual components under a specified analytical model. A blend outperforming one component alone is insufficient to demonstrate it. Researchers need suitable individual-component and combination comparisons, reproducible endpoints, and an analysis that accounts for variability.
A 2019 methods study examined how reference models influence combination analysis. It explains an important principle for evaluating blends; it did not test BPC-157 with TB-500. An interaction found in one model or endpoint would still require careful validation before wider conclusions.
Additive response models and the definition of synergy 2019
Mass proportion and molecular proportion are different because BPC-157 and the short TB-500 fragment have different molecular weights. A total powder mass alone does not establish the amount of either peptide. Salt counterions, water, and other formulation components also affect what that mass represents.
Characterization of the finished blend should identify and quantify each component and examine stability, degradation, and aggregation under the relevant study conditions. Separate ingredient results do not establish compatibility in a shared preparation.
A certificate of analysis should connect the tested sample and lot to the intended identities, methods, and actual results. Chromatographic purity, quantity, endotoxin testing, and sterility answer different questions. A high purity percentage does not establish every one of those properties or demonstrate clinical safety.
The BPC-157 and TB-500 blend is not an FDA-approved medicine. FDA’s component assessments identify limitations in clinical evidence and safety information, together with concerns about characterization, peptide-related impurities, and potential immune responses. The limited human BPC-157 literature does not establish the safety of the combination.
FDA’s TB-500 assessment distinguishes the seven-residue fragment from thymosin beta-4 and reports that it did not identify clinical studies of the fragment in humans. Those findings should not be replaced by a general claim that all thymosin research applies to TB-500.
FDA assessment of BPC 157 related bulk substances prepared for the 2026 committee
FDA assessment of TB 500 related bulk substances prepared for the 2026 committee
Compounding-list reviews and advisory recommendations are separate from approval of a finished medicine. Research labeling does not establish biological safety or authorize a separate intended use.
Research and regulatory sources checked October 15, 2026.
Because trust starts with real people, clear answers, and quality you can verify. We have a certified peptide specialist on staff, a phone number that connects you with a real human, and a physical location you can visit by appointment. Call or text us—we’re delighted to answer your questions and address your concerns. We also make checkout straightforward by accepting credit cards, without asking you to use cryptocurrency or connect your bank account to an unfamiliar payment app. And every peptide we sell is tested for purity and endotoxins by licensed U.S. laboratories, so you can choose your research peptides with confidence.
DISCLAIMER: These statements are for research purposes only and have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.
By: Laura Mildon
KLOW is a blend name used for a combination of KPV, BPC-157, TB-500, and GHK-Cu. It builds on the three-component combination commonly called GLOW by including KPV. These are separate molecular ingredients, each with its own research record. Combining them introduces a new question: what does the complete, characterized preparation do under defined experimental conditions?
The ingredient list explains the connection between the two blend names. It does not establish that KLOW produces a stronger effect than GLOW, or that results from individual ingredients transfer to the four-component combination. This article examines the terminology, chemistry, selected research, and evidence gaps.
“Stack” is informal vernacular for a combination of multiple peptides. People commonly use it when peptides are mixed together, as in a premixed blend. The word is also used more broadly for combinations discussed together even when the components are supplied separately. It is not a standardized chemical or regulatory term.
A blend describes materials physically combined in one preparation; a stack can be a broader informal description. Neither word establishes compatibility, synergy, or a validated scientific outcome. A useful description names the actual components and specifies whether the preparation is a mixture.
| Blend name | Commonly described components |
| GLOW | GHK-Cu plus BPC-157 plus TB-500 |
| KLOW | KPV plus BPC-157 plus TB-500 plus GHK-Cu |
These names do not define a universal composition, proportion, salt form, or analytical specification. In particular, TB-500 labeling may refer to a short fragment or use full-length thymosin beta-4 terminology. The exact identity must be checked rather than inferred from the blend name.
A mixture of four components has no single peptide sequence, molecular formula, or molecular weight that defines the KLOW name. Each specified ingredient needs its own chemical description. Freeze-drying components together does not, by itself, demonstrate that a new covalently linked molecule has formed.
An accurate molecular illustration would display the verified components separately, with the copper complex and TB-500 species clearly identified. Connecting four drawings into one peptide chain would depict a different chemical entity.
KPV stands for lysine-proline-valine. The letters are standard amino-acid abbreviations: K for lysine, P for proline, and V for valine. This sequence corresponds to the final three amino acid residues of alpha-melanocyte-stimulating hormone, or alpha-MSH, a longer signaling peptide. A sequence relationship does not mean the fragment reproduces every activity of the parent molecule.
| KPV identity feature | Description |
| Sequence shown here | H-Lys-Pro-Val-OH or H-KPV-OH |
| Length | 3 amino acid residues |
| Molecular formula | C₁₆H₃₀N₄O₄ for the parent free-acid peptide |
| Molecular weight | Approximately 342.43 g/mol |
| PubChem identifier | CID 125672 |
The terminal OH identifies a free carboxylic acid. Amidated versions have different terminal chemistry, while associated salts and water change the material specification. The formula above should not be assigned indiscriminately to every KPV preparation.
PubChem KPV identity sequence and authentic structural diagram
BPC-157 is a synthetic pentadecapeptide with the sequence GEPPPGKPADDAGLV. Its parent formula is C₆₂H₉₈N₁₆O₂₂, with a molecular weight of approximately 1419.5 g/mol. Salt counterions and water require separate characterization.
PubChem BPC 157 chemical identity and structure
FDA’s assessment defines TB-500 as the N-acetylated seven-residue fragment Ac-LKKTETQ, related to positions 17 through 23 of thymosin beta-4. Its parent formula is C₃₈H₆₈N₁₀O₁₄, with a molecular weight of approximately 889.0 g/mol. Full-length thymosin beta-4 has 43 residues and is a different molecule. Evidence should follow the specified substance.
FDA chemical assessment of TB 500 and its acetate form
GHK is glycine-histidine-lysine. GHK-Cu describes a complex of this peptide with copper. Copper-to-peptide proportion, protonation, counterions, and water content matter when specifying a particular material. Copper-free GHK and a copper complex should not share an unqualified formula or molecular weight.
PubChem record for the GHK peptide ligand
KPV brings a literature on inflammatory signaling and experimental delivery systems into the discussion. Inflammation involves coordinated signals and cells, and its effects depend on timing and biological context. A decrease in one inflammatory marker does not establish better repair, broad immune protection, or a clinical benefit.
Dalmasso and colleagues investigated KPV in human intestinal epithelial and immune-cell lines and in two mouse models of colitis. They reported uptake through PepT1, a transporter that carries certain small peptides into cells, alongside reductions in NF-κB and MAP kinase signaling and inflammatory measurements. NF-κB is a regulator of gene activity involved in immune responses.
The paper appeared online in 2007 and in the January 2008 issue of Gastroenterology. Human-derived cell lines are laboratory models, not a clinical trial. The findings concern KPV in those systems, without the other three KLOW ingredients.
Dalmasso and colleagues on PepT1 mediated KPV uptake in Gastroenterology 2008
Xiao and colleagues incorporated KPV into hyaluronic-acid-functionalized nanoparticles and a hydrogel system. Experiments examined cellular uptake and inflammatory and tissue outcomes in a mouse colitis model. The findings concern a designed delivery formulation. A simple four-component peptide mixture is not equivalent to that nanoparticle system.
Xiao and colleagues in Molecular Therapy 2017
A 1988 GHK-Cu study reported increased collagen synthesis in fibroblast cultures. A 2014 BPC-157 study examined growth hormone receptor expression in rat tendon fibroblasts. These are component-specific cell experiments, rather than demonstrations of KLOW’s effects.
GHK Cu and collagen synthesis in fibroblast cultures 1988
BPC 157 and growth hormone receptor expression in tendon fibroblasts 2014
A 2024 TB-500 study compared the parent peptide and metabolites in a fibroblast wound-closure assay. Only the metabolite Ac-LKKTE showed significant activity compared with the control in that assay. This result illustrates why parent peptides, metabolites, and differently named related materials should remain distinct.
TB 500 metabolite and cell screening research 2024
These publications document research milestones for the ingredients. They do not establish an original inventor, discovery date, or validated formulation for KLOW. Nor does a paper about a peptide’s relationship to a natural sequence establish a history of the four-component blend.
The targeted literature search for this article did not identify a controlled clinical trial of a fully characterized KPV, BPC-157, TB-500, and GHK-Cu combination under the KLOW name. This search finding does not exclude every possible unpublished or differently indexed experiment. Published ingredient studies should retain their actual scope.
Comparing KLOW with GLOW would require matched formulations and appropriate controls to isolate the contribution of KPV. Merely adding a fourth component does not establish greater effectiveness, and an effect of the complete mixture would not identify which ingredient or interaction produced it.
Synergy means exceeding a defined expectation based on the individual components under a specified analytical model. Different mechanisms do not prove synergy or demonstrate that pathways never overlap. A 2019 methods study explains how reference models affect combination analysis; it did not test KLOW.
Additive response models and the definition of synergy 2019
Meaningful characterization identifies and measures each ingredient in the finished preparation and examines stability, degradation, or aggregation over the relevant study period. A single chromatographic purity percentage cannot establish every component’s identity, proportion, copper content, or stability. Endotoxin testing and sterility also answer different questions.
Composition stated by mass is not the same as composition by molecule count: the components have different molecular weights. Even identical ingredient names and total powder mass do not establish that two blends are chemically equivalent.
KLOW is not an FDA-approved medicine. FDA has identified important gaps in safety information for KPV and BPC-157 and concerns involving aggregation or impurities for certain peptide preparations, including injectable GHK-Cu. Its TB-500 assessment likewise describes inadequate safety and effectiveness evidence. Combining the ingredients does not resolve those gaps.
A compounding-list review or advisory recommendation is distinct from approval of a finished drug. Research labeling does not demonstrate biological safety or authorize a separate intended use.
FDA safety considerations for certain bulk substances including KPV
Research and regulatory sources checked October 15, 2026.
Because trust starts with real people, clear answers, and quality you can verify. We have a certified peptide specialist on staff, a phone number that connects you with a real human, and a physical location you can visit by appointment. Call or text us—we’re delighted to answer your questions and address your concerns. We also make checkout straightforward by accepting credit cards, without asking you to use cryptocurrency or connect your bank account to an unfamiliar payment app. And every peptide we sell is tested for purity and endotoxins by licensed U.S. laboratories, so you can choose your research peptides with confidence.
DISCLAIMER: These statements are for research purposes only and have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.
By: Laura Mildon
GLOW is a marketplace name commonly used for blends containing GHK-Cu, BPC-157, and a material labeled TB-500. It describes a combination, rather than one newly discovered peptide. Each ingredient has its own chemistry and research history, while the finished blend introduces separate questions about identity, stability, and biological effects.
This distinction changes how the research should be read. A paper about one ingredient is evidence about that ingredient in the tested conditions. It does not establish the effects of a three-component blend. The name GLOW also does not guarantee a universal composition, proportion, or definition of TB-500.
A blend brings multiple components into one preparation. They may be supplied together as a freeze-dried powder, but sharing a container does not establish that they have become a new molecule. A chemically linked conjugate would require its own structural description. Whether components interact during formulation is a question for analytical testing.
| Property | How it applies to GLOW |
| Name | A commercial blend name rather than a unique chemical identity |
| Commonly listed components | GHK-Cu plus BPC-157 plus a substance labeled TB-500 |
| Peptide length | Each component has its own sequence and length |
| Molecular formula | No single molecular formula defines the blend name |
| Molecular weight | No single molecular weight describes all components together |
| Molecular structure | Each specified component needs its own structure |
| Discovery history | The ingredients have research milestones separate from the blend name |
| Published evidence | Ingredient studies and studies of the finished combination must be distinguished |
Supplier descriptions use both short-fragment and full-length thymosin beta-4 terminology for the TB-500 component. These are different chemical materials. A name on a label therefore needs to be reconciled with the sequence, molecular mass, and lot-specific analytical record. The exact component identities need to be established for each formulation.
The same principle applies to other named blends: the complete composition defines the preparation being studied. A familiar nickname alone cannot establish equivalence between products.
GHK stands for glycine-histidine-lysine, a three-amino-acid sequence. GHK-Cu refers to a complex involving that peptide and copper. A complex forms through coordination interactions with a metal ion, rather than by adding another amino acid to the peptide chain.
Copper-to-peptide proportion, protonation, counterions, and water content matter when defining a specific material. The formula of copper-free GHK should not be presented as the formula of GHK-Cu. Likewise, a database structure should match the intended complex rather than simply share its common name.
PubChem record for the GHK peptide ligand
BPC-157 is a synthetic pentadecapeptide, meaning it contains 15 amino acids. Its sequence is GEPPPGKPADDAGLV. The parent peptide has the formula C₆₂H₉₈N₁₆O₂₂ and a molecular weight of approximately 1419.5 g/mol. Associated salts and water require separate specifications.
PubChem BPC 157 identity and authentic structural diagram
FDA’s chemical assessment defines TB-500 as Ac-LKKTETQ, a seven-residue fragment related to positions 17 through 23 of thymosin beta-4. “Ac” indicates N-terminal acetylation. This parent fragment has the formula C₃₈H₆₈N₁₀O₁₄ and a molecular weight of approximately 889.0 g/mol. Full-length thymosin beta-4 contains 43 residues and is a different molecule.
FDA chemical characterization of TB 500 and its acetate form
The sequence, modification, and salt form should be stated explicitly. Studies of full-length thymosin beta-4 cannot automatically be assigned to the fragment, or to a blend whose TB-500 identity is unspecified.
There is no authentic single “GLOW molecule” to illustrate. An accurate scientific image would show the verified component structures separately and identify which TB-500 species and copper complex are represented. Joining their drawings into one chain would depict a different chemical entity.
The published record includes GHK-Cu fibroblast research in 1988, BPC-157 tendon-cell research in 2014, and analytical identification of the acetylated TB-500 fragment in 2012. These are component milestones. They do not establish when GLOW was first formulated, who originated the name, or that the combination was tested in those papers.
Analytical identification and synthesis of the TB 500 fragment in 2012
Maquart and colleagues reported increased collagen synthesis in fibroblast cultures exposed to GHK-Cu. Fibroblasts are cells involved in connective-tissue maintenance. This laboratory finding concerns a defined cellular endpoint. It does not demonstrate a cosmetic result, tissue repair in people, or the activity of GLOW.
Maquart and colleagues in FEBS Letters 1988
Chang and colleagues examined fibroblasts isolated from rat Achilles tendons. They reported increased growth hormone receptor expression after BPC-157 exposure and investigated responses to growth hormone. This work explores signaling in cultured cells. It does not establish repair of a human tendon or show what happens when BPC-157 is combined with GHK-Cu and TB-500.
Pentadecapeptide BPC 157 enhances growth hormone receptor expression in tendon fibroblasts
Rahaman and colleagues studied TB-500 metabolism and compared the parent peptide with breakdown products in a fibroblast wound-closure assay. Only the metabolite Ac-LKKTE showed significant activity compared with the control in that assay. A gap closing in a cultured cell layer is not equivalent to healing an injury in a person. The result also illustrates why a related fragment, metabolite, and parent peptide should remain distinct.
TB 500 and metabolite quantification and cell screening study 2024
A 2021 retrospective report described 16 people with knee pain, four of whom received a combination identified as BPC-157 and thymosin beta-4. It lacked randomization and a placebo comparison, and the combination subgroup was very small. GHK-Cu was not part of that combination. The report cannot establish the effectiveness of GLOW or resolve the identity difference between full-length thymosin beta-4 and the short fragment.
Lee and Padgett retrospective knee pain report 2021
A targeted search of PubMed-indexed literature for this article did not identify a controlled clinical trial of a fully characterized GHK-Cu, BPC-157, and TB-500 blend under the GLOW name. This is a bounded search finding, rather than proof that no combination experiment exists anywhere. Ingredient papers and studies of other combinations should retain their actual descriptions.
Synergy means that a combination exceeds a defined expectation based on its components under a specified model. A blend outperforming one ingredient alone is not sufficient to establish synergy. Investigators need appropriate single-component comparisons, combination measurements, reproducible endpoints, and an analysis that accounts for experimental variability.
Independent activity could yield an expected combined effect, a smaller effect, or an interaction that depends on the experimental conditions. A 2019 methods study examined how different reference models affect synergy estimates. It provides a way to think about combination evidence; it is not a study of GLOW.
Additive response models and the definition of synergy 2019
Sharing a vial does not establish chemical compatibility. Meaningful characterization asks whether each component remains identifiable, how much is present, and whether degradation or aggregation changes over the relevant study period. Copper coordination and peptide behavior depend on the formulation; compatibility should be measured rather than inferred from separate ingredient descriptions.
A useful certificate of analysis connects the finished blend and lot number to component-specific identity and quantity results. Chromatographic purity, peptide content, copper content, endotoxin testing, and sterility answer different questions. One purity percentage does not establish every component’s identity, the stated proportions, stability, or biological safety.
GLOW is not an FDA-approved medicine. FDA has identified limited safety information and potential immune-response concerns for BPC-157 and for injectable GHK-Cu preparations. Its TB-500 assessment also identifies gaps in safety and effectiveness evidence. Combining substances does not remove those uncertainties or validate the finished preparation.
A compounding-list review or advisory recommendation is a different regulatory process from approval of a finished drug. FDA also explains that compounded drugs are not FDA-approved. Research labeling does not establish clinical safety or authorize a separate intended use.
FDA safety concerns for certain bulk substances
FDA explanation of compounded drugs and approval
Research and regulatory sources checked October 15, 2026.
Because trust starts with real people, clear answers, and quality you can verify. We have a certified peptide specialist on staff, a phone number that connects you with a real human, and a physical location you can visit by appointment. Call or text us—we’re delighted to answer your questions and address your concerns. We also make checkout straightforward by accepting credit cards, without asking you to use cryptocurrency or connect your bank account to an unfamiliar payment app. And every peptide we sell is tested for purity and endotoxins by licensed U.S. laboratories, so you can choose your research peptides with confidence.
DISCLAIMER: These statements are for research purposes only and have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.
By: Laura Mildon
Thymosin Alpha-1, often abbreviated Tα1 or TA-1, is a peptide made from 28 amino acids. It became a subject of immune research after scientists isolated it from thymus tissue. Its synthetic counterpart is called thymalfasin. Researchers have investigated how it affects immune-cell signaling and whether those effects change clinical outcomes in specific diseases.
The scientific record includes laboratory experiments and randomized human trials, with mixed results. Biological activity does not establish a general benefit for immunity, healthy aging, or disease prevention. Understanding this peptide means looking at its identity, the people or models studied, and the outcomes actually measured.
| Property | Description |
| Common name | Thymosin Alpha-1 |
| Other names | Thymosin α1 or Tα1 or TA-1 |
| Synthetic drug substance name | Thymalfasin |
| Chemical class | Linear N-terminally acetylated peptide |
| Length | 28 amino acid residues |
| Molecular formula | C₁₂₉H₂₁₅N₃₃O₅₅ for the parent peptide |
| Molecular weight | Approximately 3108.3 g/mol |
| CAS number | 62304-98-7 |
| PubChem identifier | CID 16130571 |
The sequence is Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN-OH. “Ac” identifies the acetyl group at the beginning of the chain; “OH” identifies the free carboxylic acid at the end. These terminal features are part of the molecular identity.
The formula describes the parent peptide. An acetate-associated material also contains acetate, and water content can vary. Those components need their own characterization; the parent formula alone does not describe every research preparation.
PubChem identity sequence and verified two dimensional structure
A chemical formula tells us how many atoms a molecule contains. It does not specify their connections or spatial arrangement. The linked PubChem structure depicts the actual chemical identity. A peptide’s shape can also change with its surroundings, so a single three-dimensional rendering should not be presented as its permanent biological shape.
The thymus sits in the upper chest, behind the breastbone and above the heart. Often called a gland, it is a primary lymphoid organ: a place where an important class of immune cells develops. Its central job is to help build a diverse population of T cells that can respond to threats while limiting attacks on the body’s own tissues.
National Cancer Institute explanation of the thymus and its location
T-cell precursors originate in bone marrow and travel to the thymus. There, specialized supporting cells provide physical contact and chemical signals that guide their development. The outer cortex and inner medulla provide different environments for this process. Mature cells leave to join immune activity throughout the body; the thymus does not carry out every later immune response itself.
NIH researchers explain T cell development within the thymus
Developing T cells assemble different receptors. Positive selection preserves cells able to recognize molecular display systems called MHC on the body’s cells. Negative selection removes many cells that react too strongly to the body’s own molecular material. This establishes central tolerance, an early safeguard against autoimmunity. Selection is not perfect, so additional controls operate after cells leave the thymus.
The protein AIRE helps thymic cells produce examples of proteins normally associated with other tissues, giving developing T cells a broader sample of “self.” The thymus also generates regulatory T cells, which help restrain inappropriate immune responses. Its purpose therefore includes both immune readiness and immune restraint.
Experimental research on AIRE and self recognition in thymic cells
CD4 helper T cells coordinate responses through signals to other immune cells, while CD8 cytotoxic T cells can destroy infected or abnormal cells. Regulatory T cells help control those responses. These roles explain why a well-functioning immune system depends on appropriate cell development and regulation, rather than simply greater activity.
The thymus is especially active early in life. With age, functional tissue declines and more fat occupies the organ, a process called thymic involution. New T-cell output falls, but this does not mean the organ abruptly switches off after puberty. Existing T cells and their descendants also help maintain the adult immune-cell population.
A 2026 Nature study examined imaging-based measures of thymic health in two adult cohorts totaling more than 27,000 people and found associations with health outcomes. This observational work supports continued interest in the adult thymus; it cannot establish that changing the organ would improve those outcomes.
Thymic health consequences in adults published in Nature in 2026
The thymus is a complex cellular environment. Research on Thymosin Alpha-1 concerns one defined molecule and does not show that it reproduces the organ’s functions, restores its tissue, or reverses age-related involution.
In 1977, Allan L. Goldstein and colleagues published the isolation and sequence analysis of Thymosin Alpha-1 from calf thymus. They described a heat-stable, acidic peptide within thymosin fraction 5, a preparation containing multiple molecules. The paper connected the peptide with research on thymus-dependent lymphocytes, now commonly called T cells.
That publication is a documented milestone for the isolated peptide. Earlier work on thymus extracts should not be treated as if it already concerned a purified, chemically defined Thymosin Alpha-1 preparation. An extract containing several substances and one identified peptide are different experimental materials.
Goldstein and colleagues in Proceedings of the National Academy of Sciences 1977
The Thymosin Alpha-1 sequence corresponds to the amino-terminal portion of a larger protein, prothymosin alpha. A 2013 experimental study generated acetylated Thymosin Alpha-1 by cleaving recombinant prothymosin alpha and verified the resulting peptide with mass spectrometry. This helps explain the structural relationship without assuming that every effect of the larger protein belongs to its shorter fragment.
Generation of mature acetylated Thymosin Alpha-1 from recombinant prothymosin alpha 2013
The immune system contains cells that detect threats, relay signals, and respond to particular targets. Immune modulation means changing aspects of those responses. It does not necessarily mean increasing every response, and a stronger laboratory signal does not automatically mean a better clinical outcome.
In a 2004 study, Romani and colleagues examined dendritic cells, which help coordinate immune responses. They reported changes in cell maturation and interleukin-12 signaling through pathways involving Toll-like receptors. Experiments in susceptible mice also examined antifungal responses after hematopoietic transplantation. These findings provide a mechanistic rationale; they do not establish infection prevention in healthy people.
Dendritic cells Toll like receptor signaling and antifungal models in Blood 2004
The shared word “thymosin” can create confusion. Thymosin Alpha-1 and the 43-amino-acid thymosin beta-4 have different sequences and research histories. TB-500 is a name used for beta-4-related materials. Findings about those materials cannot establish what Thymosin Alpha-1 does. Research should follow the verified molecule, rather than a similar name.
A randomized, double-blind study enrolled 109 people with chronic hepatitis C to examine Thymosin Alpha-1 with interferon, interferon alone, or placebo. The combination produced a higher end-of-treatment biochemical response than interferon alone. A biochemical response refers to laboratory measurements, not necessarily lasting viral clearance. Because the peptide was part of combination therapy, the result does not establish that it was effective on its own.
Sherman and colleagues in Hepatology 1998
A later randomized trial enrolled 552 people whose hepatitis C had not responded to earlier interferon-based therapy. Adding Thymosin Alpha-1 to peginterferon and ribavirin did not significantly improve sustained viral response in the intention-to-treat population: 12.7% versus 10.5% with placebo. A favorable result among treatment completers should not replace the overall result, because excluding people who did not finish can distort a comparison.
These studies document a stage in hepatitis C research. Their regimens and selected populations do not establish a present-day treatment recommendation or a general antiviral effect.
Randomized adjunctive hepatitis C trial in Journal of Viral Hepatitis 2012
The single-blind ETASS trial reported results for 361 adults with severe sepsis in China. Twenty-eight-day mortality was 26.0% in the Thymosin Alpha-1 group and 35.0% in the control group. The nonstratified analysis did not reach conventional statistical significance, while a time-to-event analysis was borderline significant. This was a signal to investigate further, rather than definitive proof of a survival benefit.
Wu and colleagues in Critical Care 2013
The multicenter, double-blind, placebo-controlled TESTS trial enrolled 1106 adults with sepsis across 22 centers in China. Its modified intention-to-treat analysis included 1089 participants. Twenty-eight-day mortality was 23.4% with Thymosin Alpha-1 and 24.1% with placebo, with no statistically significant difference. The corrected hazard ratio was 0.97, with a 95% confidence interval of 0.76 to 1.24.
The journal issued a correction after data verification errors were identified; the updated analysis still did not establish a survival benefit. This large trial matters when interpreting earlier encouraging studies. Subgroup findings can generate new questions, but cannot substitute for a positive primary outcome.
TESTS trial in The BMJ 2025 with corrected results
The BMJ correction published May 30 2025
Thymosin Alpha-1 is not an FDA-approved drug ingredient in an approved product. FDA’s December 2024 evaluation explicitly stated that no drug products containing it had been approved. Overseas marketing under names such as Zadaxin does not confer United States approval, and country-specific authorizations require verification rather than repeating a global country count.
In December 2024, the Pharmacy Compounding Advisory Committee voted 17 to 4 against recommending the free-base and acetate forms for the 503A Bulks List. An advisory vote is not a marketing approval or, by itself, a final agency rule. Compounding status and drug approval are distinct regulatory questions.
FDA evaluation presented to the advisory committee December 2024
Federal advisory committee report recording the vote and agency review
FDA’s review identified concerns about immune reactions, aggregation, and impurities, as well as use in deliberately immunosuppressed populations. Those concerns coexist with trials reporting generally similar adverse-event rates between groups. Trial tolerability does not establish safety for every population or independently supplied material.
Identity, purity, peptide content, endotoxin levels, and sterility are different properties. A high chromatographic purity percentage does not establish all of them, demonstrate clinical safety, or authenticate a research material as the formulation used in a published trial.
Thymosin Alpha-1 has a documented scientific history and genuine clinical investigation. The results depend on the question being tested. Mechanistic experiments show changes in immune pathways, while clinical trials ask whether those changes improve outcomes. The distinction matters because a peptide can alter a biomarker without reducing illness or mortality.
The selected studies do not establish general immune protection, longer life, or benefits for healthy people. Hepatitis studies, transplant models, and sepsis trials address different conditions and cannot be combined into a single claim of universal immune improvement. Research materials remain separate from the medicines and experimental formulations described in the literature.
Research and regulatory sources checked October 15, 2026.
Because trust starts with real people, clear answers, and quality you can verify. We have a certified peptide specialist on staff, a phone number that connects you with a real human, and a physical location you can visit by appointment. Call or text us—we’re delighted to answer your questions and address your concerns. We also make checkout straightforward by accepting credit cards, without asking you to use cryptocurrency or connect your bank account to an unfamiliar payment app. And every peptide we sell is tested for purity and endotoxins by licensed U.S. laboratories, so you can choose your research peptides with confidence.
DISCLAIMER: These statements are for research purposes only and have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.
By: Laura Mildon
Tesamorelin is a synthetic peptide built on the 44-amino-acid sequence of human growth hormone-releasing hormone, commonly called GHRH or GRF. An analogue is a molecule designed with structural similarities to another molecule and deliberate chemical changes. Tesamorelin carries a modification at the beginning of its peptide chain.
Its history includes controlled human trials and an FDA-approved prescription medicine. The central distinction is between evidence for a particular medicine in a defined patient population and claims about any material sold under the same peptide name. This article examines chemical identity, development, selected trials, and remaining questions without providing directions for use.
| Property | Description |
| Name | Tesamorelin |
| Development code | TH9507 also written TH-9507 |
| Chemical class | Synthetic modified GHRH analogue |
| Peptide length | 44 amino acid residues |
| N-terminal modification | A trans-3-hexenoyl group attached to tyrosine |
| C-terminal feature | Amidated leucine terminus |
| Molecular formula | C₂₂₁H₃₆₆N₇₂O₆₇S for the parent peptide |
| Molecular weight | Approximately 5135.9 g/mol for the parent peptide |
| CAS number | 218949-48-5 for tesamorelin |
| FDA substance identifier | UNII MQG94M5EEO |
The peptide backbone is commonly written YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL. That letter sequence alone omits the attached hexenoyl group and terminal amide, so it is not a complete chemical description.
The parent-peptide formula excludes counterions and water. Tesamorelin acetate contains associated acetate; its total composition must be identified separately. Molecular weight, salt form, and peptide quantity should not be treated as interchangeable specifications.
FDA substance identity record for tesamorelin
PubChem chemical and sequence record
The FDA prescribing information includes a structural diagram in its Description section. It shows the sequence and N-terminal modification rather than an imagined three-dimensional shape. A formula counts atoms; the sequence, chemical connections, terminal groups, and stereochemistry define the molecule.
FDA structural diagram and chemical description in section 11
Tesamorelin emerged from Theratechnologies’ development program under the code TH9507. Its design follows human GHRH while modifying the amino terminus. A 2005 clinical publication documents an early stage of development in people with HIV and abdominal fat accumulation. Larger phase 3 studies followed. These are verifiable research milestones, rather than an exact date of first synthesis.
FDA approved the original Egrifta application on November 10, 2010. Later Egrifta formulations include SV and WR. FDA’s Purple Book records the WR formulation’s licensure on March 25, 2025. A formulation milestone concerns a named pharmaceutical product and does not grant approval to independently supplied research materials.
Early TH9507 clinical study published in 2005
FDA original approval record and development summary 2010
FDA Purple Book product history
GHRH is a signaling peptide involved in growth hormone release from the pituitary gland. Tesamorelin acts within this receptor pathway. Growth hormone and insulin-like growth factor 1, or IGF-1, are distinct downstream signals measured in the research. Tesamorelin is neither growth hormone itself nor an IGF-1 preparation.
A change in a hormonal measurement establishes biological activity under study conditions. It does not, by itself, demonstrate improved health, longer life, or better athletic performance. The clinical question depends on the population and the actual outcome measured.
Visceral adipose tissue, abbreviated VAT, lies within the abdomen around internal organs. Subcutaneous adipose tissue lies beneath the skin. Liver fat is a separate measurement concerning fat within the liver. These compartments are related to metabolism, but they are not interchangeable outcomes.
The trials often measured visceral fat as a cross-sectional area on imaging. A percentage change in that area is not a percentage change in body weight or total body fat. A study can therefore report a visceral-fat difference without demonstrating general weight loss.
Lipodystrophy describes abnormal patterns of fat distribution. The pivotal tesamorelin program concerned excess abdominal fat in adults with HIV, many receiving antiretroviral treatment. Results from that setting require careful interpretation before being generalized to unrelated populations.
This population-specific evidence is more informative than the broad phrase “fat-burning peptide.” A useful account names the people studied, the fat compartment measured, the comparison group, and the follow-up period.
Falutz and colleagues investigated TH9507 over 12 weeks in adults with HIV and abdominal fat accumulation. The largest numerical visceral-fat decrease was not statistically significant versus placebo. This early result should remain visible alongside the later positive studies: a development program can progress from uncertain findings to stronger evidence.
Falutz and colleagues in AIDS 2005
Falutz and colleagues randomized 412 adults with HIV and abdominal fat accumulation in a placebo-controlled trial lasting 26 weeks. Visceral-fat area decreased 15.2% in the tesamorelin group and increased 5.0% with placebo. Those figures describe the imaging endpoint, not body-weight loss. Most participants were men, which matters when considering how broadly the results apply.
Metabolic Effects of a Growth Hormone Releasing Factor in Patients with HIV in NEJM 2007
A pooled analysis included 806 antiretroviral-treated participants with excess abdominal fat. It supported a reduction in visceral adipose tissue, with maintenance examined during the extension period. This paper combines the phase 3 program; it should not be counted as an entirely new independent population in addition to the underlying trials.
Falutz and colleagues in Journal of Clinical Endocrinology and Metabolism 2010
A randomized study examined adults with obesity and reduced growth hormone secretion. It reported a visceral-fat reduction without a significant effect on subcutaneous abdominal fat. This offers evidence outside the HIV setting, but the selected hormonal phenotype does not represent everyone with obesity. It does not establish a general weight-management indication.
Metabolic effects in obese subjects with reduced growth hormone secretion 2012
A 2014 randomized study in 50 adults with HIV and abdominal fat accumulation reported changes in visceral and liver fat over six months. A later multicenter trial enrolled 61 people with HIV and fatty liver disease; 60 received study treatment. At 12 months, the between-group difference in hepatic fat fraction was 4.1 percentage points in favor of tesamorelin, corresponding to a reported relative effect of 37%.
Percentage points and relative percentages describe the same outcome differently. Neither figure means that body weight fell by that amount. These liver studies concern a defined population and measured outcomes, rather than proof of a general liver treatment or a new approved indication.
Stanley and colleagues in JAMA 2014
Stanley and colleagues in The Lancet HIV 2019
Russo and colleagues analyzed participants using integrase inhibitor-based HIV regimens within the earlier 61-person trial. Thirty-eight were taking these medicines at baseline; 31 completed 12 months. The analysis reported visceral- and liver-fat differences. It is a subgroup analysis of existing trial data, not a separate large trial or evidence for everyone experiencing medication-associated weight change.
Russo and colleagues in AIDS 2024
Egrifta WR is approved to reduce excess abdominal fat in adults with HIV and lipodystrophy. Its label states that it is not indicated for weight-loss management and that long-term cardiovascular safety has not been established. The label also states that Egrifta WR and Egrifta SV are not substitutable.
Approval applies to the evaluated prescription product and its labeled conditions. A research preparation does not acquire that status by sharing the ingredient name. Published trials of a pharmaceutical formulation likewise do not authenticate another supplier’s product.
The prescribing information describes elevated IGF-1, fluid retention, glucose intolerance or diabetes, and hypersensitivity among its concerns. Contraindications include active malignancy, disruption of the hypothalamic-pituitary axis, pregnancy, and known hypersensitivity. A growth-hormone-releasing mechanism should not be described as inherently free of risk because it uses an endogenous signaling pathway.
FDA prescribing information including indication limitations and safety information
Changes in fat distribution or liver-fat measurements do not by themselves establish fewer cardiovascular events, longer life, or improved athletic performance. Short-term average glucose findings also cannot establish that no individual develops a glucose-related problem. The selected trials differ in size, population, and follow-up, and their conclusions should retain those boundaries.
The evidence base includes manufacturer participation in the pivotal development program and disclosed commercial or intellectual-property relationships in later publications. Those relationships do not invalidate results, but they make transparent methods, independent scrutiny, and replication important. The 2024 subgroup paper, for example, discloses consulting relationships and a relevant patent interest.
Research questions involving liver disease should remain separate from the approved lipodystrophy indication. A positive trial, a study registration, and a regulatory approval are different milestones. The published results support specific conclusions in the tested populations, rather than every claim circulating under the peptide’s name.
The closing disclaimer concerns the research product discussed here. It does not negate the separate FDA approval of Egrifta prescription products.
Research and regulatory sources checked October 15, 2026.
Because trust starts with real people, clear answers, and quality you can verify. We have a certified peptide specialist on staff, a phone number that connects you with a real human, and a physical location you can visit by appointment. Call or text us—we’re delighted to answer your questions and address your concerns. We also make checkout straightforward by accepting credit cards, without asking you to use cryptocurrency or connect your bank account to an unfamiliar payment app. And every peptide we sell is tested for purity and endotoxins by licensed U.S. laboratories, so you can choose your research peptides with confidence.
DISCLAIMER: These statements are for research purposes only and have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.
By: Laura Mildon
TB-500 is a synthetic heptapeptide: a chain of seven amino acid residues joined by peptide bonds. The chemically defined form discussed here is N-acetyl-LKKTETQ, a modified fragment corresponding to residues 17 through 23 of thymosin beta-4. Its research spans peptide identification, metabolism, and experimental cell behavior.
The most useful starting point is its identity. TB-500 is frequently discussed alongside full-length thymosin beta-4, but those names should not be treated as interchangeable. This article explains the chemistry, historical milestones, selected original studies, and evidence gaps without turning laboratory findings into claims about a research product.
| Property | Description |
| Name discussed | TB-500 |
| Chemical class | Synthetic N-acetylated heptapeptide |
| Length | 7 amino acid residues |
| Sequence | Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln-OH |
| Abbreviated sequence | Ac-LKKTETQ |
| Relationship to thymosin beta 4 | Corresponds to residues 17 through 23 with an added N-terminal acetyl group |
| Molecular formula | C₃₈H₆₈N₁₀O₁₄ |
| Molecular weight | Approximately 889.0 g/mol |
| CAS number | 885340-08-9 |
| PubChem identifier | CID 62707662 |
Ac indicates an acetyl group at the amino terminus. The final OH indicates a free carboxylic acid terminus. These features form part of the chemical identity. The formula and weight above exclude salt counterions and associated water.
PubChem chemical identity and authentic molecular structure
Acetylation adds a chemical group to the beginning of the peptide. The unacetylated sequence LKKTETQ has the same seven amino acid residues but is a different chemical entity. Removing the acetyl group changes composition and mass, and may change how a peptide behaves in an experimental system. A paper that specifies only LKKTETQ should not automatically be counted as a study of Ac-LKKTETQ.
The linked PubChem record supplies a two-dimensional structure showing the peptide bonds, side chains, terminal groups, and stereochemistry. A formula alone counts atoms and cannot uniquely determine their arrangement. This verified structure is a more useful reference than a decorative molecular illustration.
| Substance | Chemical distinction |
| Thymosin beta 4 | The full-length 43-residue peptide |
| LKKTETQ | An unacetylated seven-residue sequence corresponding to positions 17 through 23 |
| TB-500 as defined here | Ac-LKKTETQ with N-terminal acetylation |
A fragment can preserve a sequence involved in a larger peptide’s activity while lacking other parts of that molecule. The relationship supplies a reason to investigate it; it does not establish identical binding, metabolism, distribution, or biological outcomes.
Descriptions of a 43-residue molecule under the name TB-500 should be reconciled against the actual sequence and analytical identity. Likewise, a study of a formulated thymosin beta-4 medicine or investigational product is evidence about that tested material, not automatically about the seven-residue TB-500 fragment.
Low, Hu, and Goldstein published the complete amino acid sequence of thymosin beta-4 isolated from calf thymus in 1981. They described a 43-residue peptide with an acetylated amino terminus. This is part of the parent peptide’s history, rather than the discovery date of the short TB-500 fragment.
Low and colleagues in Proceedings of the National Academy of Sciences 1981
Philp and colleagues investigated an actin-binding sequence within thymosin beta-4 using synthetic peptides, endothelial cells, and chick aortic tissue. Their work helped establish scientific interest in the short sequence. The acetylation state of the fragment matters when comparing that work with later TB-500 studies.
Philp and colleagues in The FASEB Journal 2003
Esposito and colleagues at Ghent University identified Ac-LKKTETQ in a preparation called TB-500 and synthesized the same peptide for characterization. This provides a documented identification milestone. It does not establish the exact date of the compound’s first synthesis or identify every preparation subsequently sold under that name.
Esposito and colleagues in Drug Testing and Analysis 2012
Actin is a protein that forms part of the cytoskeleton, the internal framework involved in cell shape and movement. Researchers studying the thymosin beta-4 sequence examined cell migration and vessel sprouting. These are experimental endpoints; neither is equivalent to a clinical demonstration of tissue repair.
Philp and colleagues reported endothelial-cell migration and vessel-sprouting activity associated with a seven-residue actin-binding motif. Angiogenesis means the formation of new blood vessels. These experiments concerned cultured cells and chick aortic tissue, and the unacetylated fragment should be distinguished from TB-500. The findings do not establish a treatment outcome or make angiogenesis uniformly beneficial in every biological setting.
Read the original actin binding motif study
Esposito and colleagues used chromatography and high-resolution mass spectrometry to identify the acetylated fragment. They also synthesized a reference peptide. Chromatography separates components of a sample; mass spectrometry measures ions and fragmentation patterns that can help identify a compound. This is evidence about chemical identity and detection, rather than proof of biological effectiveness.
Read the original identification and synthesis study
Ho and colleagues developed liquid chromatography–mass spectrometry methods for TB-500 in horse urine and plasma. The study belongs to the analytical and doping-control literature. Its detection findings should not be presented as a demonstration of tissue repair, clinical effectiveness, or human safety.
Ho and colleagues in Journal of Chromatography A 2012
Rahaman and colleagues measured TB-500 and its breakdown products in laboratory enzyme systems, human serum samples, and rat urine. They also compared biological activity in cultured fibroblasts. A metabolite is a compound produced when another substance is chemically transformed.
In their fibroblast assay, the metabolite Ac-LKKTE showed significant wound-closure activity compared with the control; the parent TB-500 did not. A scratch assay measures how cells fill a gap in a cell layer. It does not reproduce all the features of an injury in a living organism. Human serum used in a laboratory experiment does not make the work a human clinical trial.
Rahaman and colleagues in Journal of Chromatography B 2024
A paper published in Biomaterials Research on September 30, 2026 examined N-acetyl-L-leucyl-L-lysine, abbreviated Ac-LK, as a TB-500 metabolite. Its experiments included endothelial-cell functional assays, protein profiling, and an in-vivo wound-healing model. The authors reported stronger activity for Ac-LK on selected endpoints and proposed a peptide prodrug mechanism, in which a breakdown product contributes to activity.
This is a preclinical mechanism proposal. Ac-LK is different from Ac-LKKTE examined in the 2024 assay; the studies should not be collapsed into a single claim about an active metabolite. Their different systems and endpoints leave further questions about how each observation relates to the intact parent peptide.
Functional Characterization of N acetyl L Leucyl L Lysine in Biomaterials Research 2026
The research record raises useful questions about the intact peptide, related fragments, and metabolites. It does not establish that a change in one cell assay predicts a clinical outcome, or that every preparation labeled TB-500 contains the same chemical material. Results depend on the specified sequence, chemical modifications, experimental model, and outcome measured.
FDA’s 2026 compounding assessment reported that it had not identified clinical information in which TB-500 was used to treat a disease or condition. It also identified gaps in toxicology and clinical safety evidence, alongside potential immune-response concerns involving aggregation and peptide-related impurities. Absence of a reported problem in a small laboratory experiment does not resolve these questions.
FDA scientific assessment of TB-500 and TB-500 acetate prepared for the 2026 committee
TB-500 is not an FDA-approved medicine. The July 2026 Pharmacy Compounding Advisory Committee materials concern TB-500 and TB-500 acetate as proposed bulk substances for drug compounding. A scientific review, advisory recommendation, or compounding-list decision should not be represented as approval of a finished drug or validation of a research product’s safety and effectiveness.
FDA meeting materials for July 23 and 24 2026
The scientific assessment concerns specific substances and a regulatory framework. It should not be summarized as a blanket prohibition on laboratory research. Equally, research labeling does not authorize a separate intended use.
A result labeled “purity” does not, by itself, establish whether the sample contains the acetylated fragment, the unacetylated sequence, or full-length thymosin beta-4. A meaningful analytical record connects the sample and lot to the intended sequence, expected mass, testing methods, and actual results.
Purity, identity, quantity, and endotoxin testing answer different questions. An endotoxin result does not establish sterility or clinical safety. Findings from a characterized research reagent also do not authenticate a different supplier’s material. The 2012 identification study illustrates why the molecule must be established before biological claims can be interpreted.
Research and regulatory sources checked October 15, 2026.
Because trust starts with real people, clear answers, and quality you can verify. We have a certified peptide specialist on staff, a phone number that connects you with a real human, and a physical location you can visit by appointment. Call or text us—we’re delighted to answer your questions and address your concerns. We also make checkout straightforward by accepting credit cards, without asking you to use cryptocurrency or connect your bank account to an unfamiliar payment app. And every peptide we sell is tested for purity and endotoxins by licensed U.S. laboratories, so you can choose your research peptides with confidence.
DISCLAIMER: These statements are for research purposes only and have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.
By: Laura Mildon
SS-31 is a synthetic peptide containing four amino acid residues. It is also known as elamipretide, MTP-131, and Bendavia in the research literature. Its scientific interest centers on interactions with the inner mitochondrial membrane, where cells carry out much of their energy production.
Its regulatory history requires precision. In September 2025, FDA granted accelerated approval to the prescription medicine Forzinity, containing elamipretide, for a specific Barth syndrome indication. That approval does not extend to research materials labeled SS-31 or establish general wellness, longevity, or performance benefits. This article examines the molecule and its published research without providing directions for use.
| Property | Description |
| Research name | SS-31 |
| Nonproprietary name | Elamipretide |
| Other development names | MTP-131 and Bendavia |
| Chemical class | Synthetic modified tetrapeptide |
| Sequence | D-Arg–Dmt–Lys–Phe–NH₂ |
| Dmt meaning | 2ʹ,6ʹ-dimethyl-L-tyrosine |
| Terminal feature | Carboxyl-terminal amide |
| Molecular formula | C₃₂H₄₉N₉O₅ for the parent peptide |
| Molecular weight | Approximately 639.8 g/mol for the parent peptide |
| PubChem identifier | CID 11764719 |
The D designation on arginine specifies its stereochemistry, or spatial arrangement. Dmt is a modified tyrosine residue. These details and the terminal amide are part of the molecule’s identity; a four-letter sequence alone would omit them.
The formula above describes the parent peptide. A hydrochloride or other salt includes counterions and has a different formula and formula weight. The FDA-approved medicine contains elamipretide hydrochloride; an ingredient name alone does not make a research preparation equivalent to that medicine.
PubChem chemical identity and authentic two dimensional structure
The linked PubChem record provides a structure based on defined chemical connectivity and stereochemistry. A molecular formula counts atoms but cannot uniquely determine their arrangement. An accurate illustration must preserve the D-arginine residue, the methyl groups on tyrosine, and the terminal amide.
SS refers to Szeto–Schiller, the peptide family associated with Hazel H. Szeto and Peter W. Schiller. These peptides were designed synthetically rather than isolated as naturally occurring human peptides. A foundational 2004 paper by Zhao and colleagues described the family’s mitochondrial targeting and antioxidant behavior. That publication is a documented early milestone, rather than proof of an exact first-synthesis date.
A later mechanistic study by Birk and colleagues in 2013 linked SS-31 to cardiolipin, a phospholipid enriched in the inner mitochondrial membrane. The research moved beyond describing an antioxidant effect to examining interactions with a specific membrane component.
Mitochondria produce ATP, a molecule that cells use to transfer energy. Their inner membrane forms folds called cristae and contains proteins involved in electron transport. Cardiolipin helps organize this membrane and its protein machinery.
Laboratory studies examined how SS-31 interacts with cardiolipin and influences the behavior of cytochrome c, a protein involved in electron transfer. Under some experimental conditions, cytochrome c can also participate in reactions that damage membrane lipids. These experiments help explain the research rationale; they do not establish a universal effect in every tissue or disease.
Zhao and colleagues studied synthetic peptide antioxidants in cultured neuronal cells, isolated mitochondria, and an isolated-heart model. They reported reduced oxidative injury and changes in mitochondrial swelling and cytochrome c release. This was foundational preclinical work on the SS peptide family, not a clinical demonstration of broad benefits from SS-31.
Zhao and colleagues in Journal of Biological Chemistry 2004
Birk and colleagues investigated SS-31 using biochemical experiments and a rat model of interrupted kidney blood supply followed by restoration of flow. Their findings connected cardiolipin binding with mitochondrial membrane structure and energy recovery in that experimental setting. The model does not establish a clinical kidney indication.
Birk and colleagues in Journal of the American Society of Nephrology 2013
Thompson and colleagues reported a randomized, blinded crossover trial involving 12 participants. The controlled phase did not meet its primary walking-distance and fatigue endpoints. Improvements reported during the subsequent open-label extension deserve separate interpretation because that phase lacked a concurrent blinded placebo comparison. The study included a manufacturer-employed author.
Thompson and colleagues in Genetics in Medicine 2021
The MMPOWER-3 phase 3 trial randomized 218 participants with primary mitochondrial myopathy. It did not meet its primary endpoints for walking distance or fatigue at 24 weeks. This negative result is important: a plausible mitochondrial mechanism does not guarantee improvement across mitochondrial disorders.
MMPOWER 3 randomized trial in Neurology 2023
The TAZPOWER extension publication reported longer-term observations in a small cohort: 10 participants entered the extension and eight reached week 168. The authors reported improvements in functional measures. The absence of a concurrent placebo group and the small number of participants limit causal interpretation and generalization.
TAZPOWER open label extension in Genetics in Medicine 2024
On September 19, 2025, FDA granted accelerated approval to Forzinity to improve muscle strength in adults and pediatric patients with Barth syndrome weighing at least 30 kg. Barth syndrome is a rare genetic disorder involving abnormal cardiolipin metabolism. This is a specific prescription-drug indication, not an over-the-counter supplement authorization.
FDA based accelerated approval on improved knee extensor strength, a measure considered reasonably likely to predict patient benefit. The agency required a randomized, blinded, placebo-controlled post-approval trial to confirm that this change translates into patient benefit. Accelerated approval is an FDA approval pathway with a requirement to verify benefit; it should not be described as proof of every proposed use.
FDA announcement of accelerated approval in September 2025
A research product labeled SS-31 is not Forzinity. Shared chemical terminology does not establish equivalent manufacturing controls, formulation, purity, sterility, or regulatory authorization. FDA approval of the named medicine cannot be transferred to a separate research product.
FDA prescribing information for Forzinity including chemistry and clinical studies
SS-31 is a defined synthetic tetrapeptide with substantial mechanistic research and disease-specific clinical development. The evidence includes early laboratory findings, clinical trials with unmet primary endpoints, and an accelerated approval for one medicine and indication. Claims about reversing aging, improving everyday energy, or enhancing athletic performance do not follow from that record.
This article concerns scientific and regulatory context. The closing disclaimer refers to the research product discussed here and does not negate the separate FDA approval of Forzinity.
Sources and regulatory context checked October 15, 2026.
Because trust starts with real people, clear answers, and quality you can verify. We have a certified peptide specialist on staff, a phone number that connects you with a real human, and a physical location you can visit by appointment. Call or text us—we’re delighted to answer your questions and address your concerns. We also make checkout straightforward by accepting credit cards, without asking you to use cryptocurrency or connect your bank account to an unfamiliar payment app. And every peptide we sell is tested for purity and endotoxins by licensed U.S. laboratories, so you can choose your research peptides with confidence.
DISCLAIMER: These statements are for research purposes only and have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.
By: Laura Mildon
SNAP-8 is a trade name associated with the synthetic cosmetic peptide Acetyl Octapeptide-3. An octapeptide contains eight amino acid residues. The name also appears on supplier ingredient solutions, so it is important to distinguish the peptide molecule, a diluted ingredient blend, and a finished cosmetic.
This article explains its chemistry, development, selected research, and verified examples of nonprescription retail cosmetics. Retail presence documents an ingredient listing; it does not establish the effectiveness of an isolated peptide or an intended use for a research material.
| Property | Description |
| Common trade name | SNAP-8 |
| Cosmetic ingredient name | Acetyl Octapeptide-3 |
| Chemical class | Synthetic modified octapeptide |
| Length | 8 amino acid residues |
| Sequence discussed | Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH₂ |
| Terminal modifications | Amino-terminal acetyl group and carboxyl-terminal amide |
| Molecular formula | C₄₁H₇₀N₁₆O₁₆S |
| Molecular weight | Approximately 1075.2 g/mol |
| CAS number | 868844-74-0 |
The chemistry above follows the sequence diagram and formula in Cayman Chemical’s specification. Public database records using the same ingredient name are not entirely consistent, so a name search alone should not settle molecular identity. Sequence, terminal groups, formula, and structure must agree.
Sequence diagram and chemical specification from Cayman Chemical
Lubrizol lists a branded SNAP-8 peptide solution C. Supplier solutions contain the peptide together with a carrier and potentially other formulation ingredients. The amount of an ingredient solution is therefore different from the amount of pure peptide.
An INCI name is a standardized cosmetic ingredient label name. A finished product listing Acetyl Octapeptide-3 does not necessarily identify the peptide supplier, establish use of the SNAP-8 trademarked solution, or disclose the peptide concentration.
Current branded ingredient listing from Lubrizol
SNAP-8 belongs to Lipotec’s cosmetic peptide development lineage, now represented by Lubrizol. Supplier literature describes it as an extension of the related hexapeptide Argireline. It was designed rather than isolated unchanged from a natural source.
The design rationale concerns SNAP-25, a protein involved in SNARE complexes that help cellular vesicles fuse with membranes. A vesicle is a small membrane-enclosed compartment. This cellular mechanism should be distinguished from demonstrated performance of a finished cosmetic.
A 2002 publication describes Argireline, the related six-residue peptide. It provides historical background, but it is not a SNAP-8 trial. The supplier brochure below documents SNAP-8-specific development claims; it does not establish an exact first-synthesis date.
Blanes-Mira and colleagues on Argireline 2002 background only
Lipotec SNAP-8 supplier brochure and study summary
SNAP-8 is not FDA-approved as a medicine. Research involving a formulation is evidence about that tested system, rather than proof that a research peptide or every retail product has the same effect.
The Lipotec brochure reports laboratory assays involving SNARE complex formation and neurotransmitter release, plus a cosmetic evaluation in 17 volunteers. It reports a maximum wrinkle-depth reduction, rather than identifying that figure as the average response.
This is manufacturer-provided evidence. The short brochure does not establish a blinded, vehicle-controlled design. Its reported maximum should not be turned into a typical result or a claim of equivalence to a drug.
Ji and colleagues developed a liquid chromatography–tandem mass spectrometry method to measure Acetyl Octapeptide-3 and applied it to microneedle patches. Chromatography separates sample components; mass spectrometry helps identify and quantify them.
This study supports analytical measurement in the tested matrix. It does not demonstrate cosmetic effectiveness, and a product label is not a substitute for such chemical measurement.
Ji and colleagues in Journal of Analytical Science and Technology 2020
Avcil and colleagues studied hyaluronic-acid microneedle patches containing Acetyl Octapeptide-3 and several other bioactive ingredients. Shin and colleagues later evaluated a different combined formulation in 24 participants against a hyaluronic-acid placebo patch.
The 2024 study reported differences in wrinkle-related measurements. Both papers concern engineered patches containing multiple ingredients. They do not isolate the contribution of Acetyl Octapeptide-3 or establish equivalent results for an ordinary serum. Company involvement in this research also warrants attention when assessing independence.
Avcil and colleagues in Journal of Cosmetic Dermatology 2020
Shin and colleagues in Annals of Dermatology 2024
Four distinct products from four brands were verified through official product or ingredient pages on October 13, 2026. Each lists Acetyl Octapeptide-3. This is a documented sample, not a count of every product worldwide, a recommendation, or confirmation that the brand uses Lubrizol’s proprietary SNAP-8 solution.
| Brand | Product listing verified |
| Peach and Lily | Glass Skin Refining Serum |
| DRMTLGY | Vitamin C E + F |
| iS Clinical | Youth Eye Complex |
| Revision Skincare | Revox Line Relaxer |
The sample shows that the cosmetic ingredient appears in multiple finished consumer formulations, including serums and an eye product. The label may use Acetyl Octapeptide-3 without mentioning SNAP-8.
An ingredient list does not establish its measured concentration, stability throughout shelf life, penetration, or contribution to a product’s results. A formula can contain several peptides, humectants, and other ingredients, so the performance of the whole product cannot be credited to one component without an appropriate comparison.
Those accustomed to making their own cosmetics can buy SNAP-8 to use in more precise concentrations for homemade serums, lotions and creams.
A percentage attached to a branded solution may describe the amount of that solution in a formula, rather than the amount of pure peptide. The supplier’s documentation must make the denominator clear before figures can be compared.
Likewise, a reported maximum, an average, a before-and-after observation, and a difference against a placebo are distinct results. Claims should retain those distinctions and identify the actual formulation tested.
A molecular formula only counts atoms; it cannot uniquely determine a structure. The sequence and terminal modifications define the chemical entity discussed here. The linked Cayman specification provides its actual chemical diagram, rather than a decorative molecule drawing.
The key unresolved question is how much evidence isolates this peptide’s contribution within finished formulations. Mechanistic plausibility, measurement of peptide content, and observed cosmetic outcomes answer different questions.
Research involving microneedle patches cannot establish the behavior of a conventional cream or serum. Small, short studies also do not establish long-term outcomes, safety in every population, or universal effects across formulations.
Argireline is a related hexapeptide, not the same octapeptide. Its studies should not be counted as SNAP-8 evidence. Marketing comparisons with botulinum toxin likewise do not establish chemical, clinical, or regulatory equivalence.
“Over the counter” is often used conversationally to mean available without a prescription. For this article, the more precise description is nonprescription retail cosmetics. That is different from an FDA-regulated OTC drug category.
FDA explains that cosmetics and cosmetic ingredients generally do not require premarket approval, with an exception for certain color additives. Manufacturers remain responsible for complying with applicable requirements. Retail availability therefore does not mean that FDA approved the peptide’s effectiveness.
Intended use and claims determine whether a product is a cosmetic, drug, or both. Cosmetic claims concerning appearance differ from disease claims or claims to affect body structure or function. “Cosmeceutical” is not a separate legal category recognized by FDA.
FDA explanation of cosmetics versus drugs
A finished cosmetic, a supplier ingredient solution, and a research peptide are different materials. The retail examples do not authorize a different intended use of a laboratory material.
Research, ingredient listings, and regulatory sources checked October 13, 2026.
DISCLAIMER: These statements are for research purposes only and have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.
Because trust starts with real people, clear answers, and quality you can verify. We have a certified peptide specialist on staff, a phone number that connects you with a real human, and a physical location you can visit by appointment. Call or text us—we’re delighted to answer your questions and address your concerns. We also make checkout straightforward by accepting credit cards, without asking you to use cryptocurrency or connect your bank account to an unfamiliar payment app. And every peptide we sell is tested for purity and endotoxins by licensed U.S. laboratories, so you can choose your research peptides with confidence.
By: Laura Mildon
Semax is a synthetic heptapeptide: a chain of seven amino acids joined by peptide bonds. Its sequence is methionine–glutamic acid–histidine–phenylalanine–proline–glycine–proline, abbreviated MEHFPGP. Its research history includes investigation of neurotrophic signaling and responses to experimental brain injury.
Although frequently mentioned alongside Selank, Semax is a different molecule with a different sequence and research lineage. Published findings do not establish a benefit or intended application for a commercial research material.
ACTH stands for adrenocorticotropic hormone. Semax contains the sequence corresponding to ACTH residues 4 through 7, Met-Glu-His-Phe, followed by Pro-Gly-Pro. It is therefore described structurally as ACTH 4–7 PGP.
Older publications also describe it as an ACTH 4–10 analogue. That describes its design relationship rather than an unchanged copy of the natural 4–10 sequence. The full ACTH hormone and Semax should not be treated as the same compound.
| Property | Description |
| Name | Semax |
| Chemical class | Synthetic linear heptapeptide |
| Length | 7 amino acids |
| Sequence | Met-Glu-His-Phe-Pro-Gly-Pro; MEHFPGP |
| Molecular formula | C₃₇H₅₁N₉O₁₀S |
| Molecular weight | Approximately 813.9 g/mol |
| PubChem identifier | CID 9811102 |
| CAS number | 80714-61-0 |
| Form described | Unmodified peptide with free termini, without counterions |
These values describe the specified peptide entity. Salt counterions, hydration, and terminal modifications require separate identification. N-acetyl Semax, amidated Semax, and an acetate salt are not interchangeable chemical descriptions.
PubChem chemical identity and structure
FDA chemical comparison of Semax and Semax acetate
Both peptides contain seven residues and end in Pro-Gly-Pro. Semax begins with Met-Glu-His-Phe, derived from an ACTH fragment. Selank begins with Thr-Lys-Pro-Arg, the tuftsin sequence.
Sharing a short terminal sequence does not make their molecular interactions or biological effects equivalent. Evidence about one molecule, or about the terminal fragment alone, cannot automatically be transferred to the other.
Semax emerged from Russian research into regulatory peptides and ACTH-derived sequences. A 1997 publication by Ashmarin and colleagues summarized approximately 15 years of design and investigation, documenting an earlier development program.
That retrospective report is a historical milestone, rather than proof of an exact discovery or first-synthesis date. Semax is a designed synthetic analogue, not a peptide isolated unchanged from a natural source.
Ashmarin and colleagues 1997 Russian-language development report
Semax is not FDA-approved as a medicine. These selected original studies address molecular and preclinical questions; they do not establish a clinical benefit or authenticate a commercial research material.
Dolotov and colleagues investigated Semax binding and brain-derived neurotrophic factor, or BDNF, in rat basal forebrain. Their study reported increased BDNF protein levels in that experimental setting.
BDNF is a signaling protein involved in neuronal functions and plasticity. A change in its measured level does not, by itself, demonstrate better memory, improved mood, or another clinical outcome in people.
Original study in Journal of Neurochemistry 2006
Dolotov and colleagues examined BDNF and its receptor TrkB in the rat hippocampus. They reported changes in protein levels, gene expression, and receptor phosphorylation after Semax exposure.
Phosphorylation adds a phosphate group to a protein and can alter signaling activity. These were molecular measurements in a rat brain region. They should not be summarized as proof that Semax improves human cognition or regenerates brain tissue.
Original study in Brain Research 2006
Medvedeva and colleagues used a rat model of focal cerebral ischemia, a restriction of blood supply to a defined brain area. They compared gene-expression patterns after Semax exposure with those in the ischemia comparison group.
The researchers reported changes involving immune and vascular processes. This study addresses responses in an experimental injury model; it does not establish prevention or treatment of stroke in people. Findings from the complete peptide also need to be distinguished from findings about shorter fragments.
Medvedeva and colleagues in BMC Genomics 2014
The molecular formula counts atoms; the sequence specifies their order along the peptide chain. PubChem provides a two-dimensional chemical depiction of the identified compound. This connectivity diagram is not an experimentally established fixed three-dimensional shape.
Important questions include which molecular interactions explain specific responses, how reproducible those responses are across research groups, and how laboratory measurements relate to meaningful clinical outcomes.
The selected studies do not resolve long-term human safety or effectiveness. Increasing a neurotrophic marker is different from demonstrating a lasting functional improvement. Results also depend on the biological model and the exact material studied.
Clinical reports exist in the broader literature, but FDA’s 2026 assessment identified limitations in evidence and noted that clinical references did not clearly distinguish the free peptide from its acetate salt. Animal studies, molecular assays, and human clinical reports require separate appraisal.
FDA’s 2026 compounding assessment states that neither Semax nor Semax acetate is a component of an FDA-approved drug. It also notes that Semax is a registered drug in Russia. Registration in one country does not establish approval in another or authenticate an independently supplied research preparation.
The assessment identifies concerns about chemical characterization and the available safety and effectiveness evidence. It was prepared for an advisory committee addressing compounding questions; a briefing document or committee recommendation is different from approval of a medicine.
Research labeling does not establish FDA approval, clinical safety, or permission for another intended use.
FDA assessment of Semax and Semax acetate 2026
Research and regulatory sources checked October 13, 2026.
DISCLAIMER: These statements are for research purposes only and have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.
Because trust starts with real people, clear answers, and quality you can verify. We have a certified peptide specialist on staff, a phone number that connects you with a real human, and a physical location you can visit by appointment. Call or text us—we’re delighted to answer your questions and address your concerns. We also make checkout straightforward by accepting credit cards, without asking you to use cryptocurrency or connect your bank account to an unfamiliar payment app. And every peptide we sell is tested for purity and endotoxins by licensed U.S. laboratories, so you can choose your research peptides with confidence.
By: Laura Mildon
Selank is a synthetic heptapeptide: a chain of seven amino acids joined by peptide bonds. Its sequence is threonine–lysine–proline–arginine–proline–glycine–proline, abbreviated TKPRPGP. Researchers investigate its effects on signaling processes and gene expression.
Its history is associated with Russian peptide research. It is more accurately described as a designed analogue than as a molecule discovered in nature. The relationship to a natural peptide does not establish a benefit or intended use for a commercial research material.
Tuftsin is a naturally occurring four-amino-acid peptide with the sequence Thr-Lys-Pro-Arg, or TKPR. Selank contains that sequence followed by Pro-Gly-Pro, making a seven-residue chain.
An analogue is a molecule designed with similarities to another molecule and deliberate structural changes. Adding residues changes chemical identity; findings about tuftsin should not automatically be attributed to Selank.
| Property | Description |
| Name | Selank |
| Related research designation | TP-7 |
| Chemical class | Synthetic linear heptapeptide |
| Length | 7 amino acids |
| Sequence | Thr-Lys-Pro-Arg-Pro-Gly-Pro; TKPRPGP |
| Molecular formula | C₃₃H₅₇N₁₁O₉ |
| Molecular weight | Approximately 751.9 g/mol |
| PubChem identifier | CID 11765600 |
| CAS number | 129954-34-3 |
These values describe the unmodified peptide with free termini, without a salt counterion. Acetate salts, hydration, and terminal modifications require separate identification. A material called N-acetyl Selank or amidated Selank is chemically different from the peptide described here.
PubChem chemical identity and sequence
Some publications describe Selank as an anxiolytic or nootropic. Anxiolytic refers to an effect on anxiety-related measures; nootropic refers broadly to cognitive effects. These terms identify questions being investigated, rather than proving that a research product produces those outcomes.
The experimental model matters. Changes in a rat brain sample, a cultured-cell assay, and a clinical symptom scale represent different kinds of evidence and should be described separately.
Selank’s published research lineage includes Russian investigators studying regulatory peptides and tuftsin analogues. Work from the Institute of Molecular Genetics of the Russian Academy of Sciences in Moscow documents investigation of its molecular effects.
The sources selected here establish the synthetic sequence and a Russian research history. They do not establish an exact first-synthesis date. A publication date, a patent milestone, and authorization of a particular medicine would represent different historical events.
Original research from the Institute of Molecular Genetics in Moscow 2016
Selank is not FDA-approved as a medicine. These selected publications describe limited clinical and experimental evidence; they do not establish an intended application for a research product.
Zozulia and colleagues reported a study of 62 patients described as having generalized anxiety disorder or neurasthenia. They compared Selank in 30 participants with medazepam in 32, using symptom scales and a serum enkephalin-related measurement.
The authors reported similar anxiety-related effects between groups. The indexed abstract does not establish a placebo-controlled, blinded design. Its small sample and reporting limitations mean it should not be presented as definitive proof of effectiveness or long-term safety.
Zozulia and colleagues 2008 English abstract of a Russian-language article
Kolomin and colleagues investigated changes in the hippocampal transcriptome after Selank exposure in a rat model. A transcriptome is the collection of RNA transcripts produced from genes; the hippocampus is a brain region involved in processes including learning and memory.
The study addresses molecular responses in an experimental system. A change in gene expression does not establish improved cognition or a clinical benefit in people.
Kolomin and colleagues 2013 indexed research report
Volkova and colleagues examined 84 neurotransmission-related genes in rat frontal cortex after Selank or GABA exposure. They reported changes in expression and similarities in some responses, suggesting possible involvement of the GABAergic system.
GABA is a neurotransmitter involved in inhibitory signaling. This study generated a mechanistic hypothesis; it does not prove that Selank acts exactly like GABA or a benzodiazepine, or establish the same effects in humans.
Volkova and colleagues in Frontiers in Pharmacology 2016
The molecular formula counts atoms; the sequence specifies their order along the peptide chain. PubChem provides a two-dimensional chemical depiction of Selank. That connectivity diagram should not be described as an experimentally established fixed three-dimensional shape.
Important questions include which molecular interactions drive particular effects, reproducibility across research groups, and the relationship between laboratory measurements and meaningful clinical outcomes. The selected studies do not resolve long-term human safety or effectiveness.
The country of origin does not determine the strength of evidence. Study design, sample size, controls, reporting, and independent replication matter. Russian-language publications should be evaluated on those features rather than accepted or dismissed because of their language.
Findings about unmodified Selank, tuftsin, or a particular pharmaceutical formulation cannot automatically establish the behavior of an acetylated analogue, amidated variant, blend, or independently supplied research material.
FDA’s compounding safety notice specifically identifies Selank acetate, also labeled TP-7. It describes potential immune-response risks associated with peptide aggregation and impurities and states that important human safety information is lacking.
This is a substance-specific compounding notice, rather than a blanket prohibition on laboratory research. A reference to Russian clinical research or a substance registry does not establish FDA approval. Research labeling does not establish clinical safety or permission for another intended use.
FDA notice on Selank acetate and compounding risks
Research and regulatory sources checked October 13, 2026.
DISCLAIMER: These statements are for research purposes only and have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.
Because trust starts with real people, clear answers, and quality you can verify. We have a certified peptide specialist on staff, a phone number that connects you with a real human, and a physical location you can visit by appointment. Call or text us—we’re delighted to answer your questions and address your concerns. We also make checkout straightforward by accepting credit cards, without asking you to use cryptocurrency or connect your bank account to an unfamiliar payment app. And every peptide we sell is tested for purity and endotoxins by licensed U.S. laboratories, so you can choose your research peptides with confidence.
All products offered by Trace Tides are intended for laboratory research use only. These materials are not for human or veterinary consumption, medical use, diagnostic procedures, or therapeutic applications. Trace Tides supplies products exclusively to qualified professionals and licensed research institutions. Statements on this website are for informational and educational purposes only and have not been evaluated by the U.S. Food and Drug Administration (FDA). By accessing this site, you confirm that you are a qualified researcher or institution representative and agree to use all materials in accordance with applicable laws, regulations, and safety guidelines.
This website is restricted. To continue, please confirm you meet the minimum age requirement and accept the agreement below.
Both confirmations are required to continue. If you do not meet these requirements, please close this page.
