A Trace ‘Tides Primer: Understanding a modified growth hormone releasing hormone analogue

By: Laura Mildon

Tesamorelin is a synthetic peptide built on the 44-amino-acid sequence of human growth hormone-releasing hormone, commonly called GHRH or GRF. An analogue is a molecule designed with structural similarities to another molecule and deliberate chemical changes. Tesamorelin carries a modification at the beginning of its peptide chain.

Its history includes controlled human trials and an FDA-approved prescription medicine. The central distinction is between evidence for a particular medicine in a defined patient population and claims about any material sold under the same peptide name. This article examines chemical identity, development, selected trials, and remaining questions without providing directions for use.

Chemical identity

The peptide backbone is commonly written YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL. That letter sequence alone omits the attached hexenoyl group and terminal amide, so it is not a complete chemical description.

The parent-peptide formula excludes counterions and water. Tesamorelin acetate contains associated acetate; its total composition must be identified separately. Molecular weight, salt form, and peptide quantity should not be treated as interchangeable specifications.

FDA substance identity record for tesamorelin

PubChem chemical and sequence record

Molecular structure

The FDA prescribing information includes a structural diagram in its Description section. It shows the sequence and N-terminal modification rather than an imagined three-dimensional shape. A formula counts atoms; the sequence, chemical connections, terminal groups, and stereochemistry define the molecule.

FDA structural diagram and chemical description in section 11

Development history and the biology being studied

A designed analogue rather than a natural discovery

Tesamorelin emerged from Theratechnologies’ development program under the code TH9507. Its design follows human GHRH while modifying the amino terminus. A 2005 clinical publication documents an early stage of development in people with HIV and abdominal fat accumulation. Larger phase 3 studies followed. These are verifiable research milestones, rather than an exact date of first synthesis.

FDA approved the original Egrifta application on November 10, 2010. Later Egrifta formulations include SV and WR. FDA’s Purple Book records the WR formulation’s licensure on March 25, 2025. A formulation milestone concerns a named pharmaceutical product and does not grant approval to independently supplied research materials.

Early TH9507 clinical study published in 2005

FDA original approval record and development summary 2010

FDA Purple Book product history

How GHRH relates to growth hormone

GHRH is a signaling peptide involved in growth hormone release from the pituitary gland. Tesamorelin acts within this receptor pathway. Growth hormone and insulin-like growth factor 1, or IGF-1, are distinct downstream signals measured in the research. Tesamorelin is neither growth hormone itself nor an IGF-1 preparation.

A change in a hormonal measurement establishes biological activity under study conditions. It does not, by itself, demonstrate improved health, longer life, or better athletic performance. The clinical question depends on the population and the actual outcome measured.

Visceral fat is different from fat beneath the skin

Visceral adipose tissue, abbreviated VAT, lies within the abdomen around internal organs. Subcutaneous adipose tissue lies beneath the skin. Liver fat is a separate measurement concerning fat within the liver. These compartments are related to metabolism, but they are not interchangeable outcomes.

The trials often measured visceral fat as a cross-sectional area on imaging. A percentage change in that area is not a percentage change in body weight or total body fat. A study can therefore report a visceral-fat difference without demonstrating general weight loss.

Why the HIV context matters

Lipodystrophy describes abnormal patterns of fat distribution. The pivotal tesamorelin program concerned excess abdominal fat in adults with HIV, many receiving antiretroviral treatment. Results from that setting require careful interpretation before being generalized to unrelated populations.

This population-specific evidence is more informative than the broad phrase “fat-burning peptide.” A useful account names the people studied, the fat compartment measured, the comparison group, and the follow-up period.

Selected clinical studies and their limits

An early placebo controlled study in 2005

Falutz and colleagues investigated TH9507 over 12 weeks in adults with HIV and abdominal fat accumulation. The largest numerical visceral-fat decrease was not statistically significant versus placebo. This early result should remain visible alongside the later positive studies: a development program can progress from uncertain findings to stronger evidence.

Falutz and colleagues in AIDS 2005

A pivotal phase 3 trial in 2007

Falutz and colleagues randomized 412 adults with HIV and abdominal fat accumulation in a placebo-controlled trial lasting 26 weeks. Visceral-fat area decreased 15.2% in the tesamorelin group and increased 5.0% with placebo. Those figures describe the imaging endpoint, not body-weight loss. Most participants were men, which matters when considering how broadly the results apply.

Metabolic Effects of a Growth Hormone Releasing Factor in Patients with HIV in NEJM 2007

Two phase 3 studies pooled in 2010

A pooled analysis included 806 antiretroviral-treated participants with excess abdominal fat. It supported a reduction in visceral adipose tissue, with maintenance examined during the extension period. This paper combines the phase 3 program; it should not be counted as an entirely new independent population in addition to the underlying trials.

Falutz and colleagues in Journal of Clinical Endocrinology and Metabolism 2010

A different selected population in 2012

A randomized study examined adults with obesity and reduced growth hormone secretion. It reported a visceral-fat reduction without a significant effect on subcutaneous abdominal fat. This offers evidence outside the HIV setting, but the selected hormonal phenotype does not represent everyone with obesity. It does not establish a general weight-management indication.

Metabolic effects in obese subjects with reduced growth hormone secretion 2012

Liver fat research in 2014 and 2019

A 2014 randomized study in 50 adults with HIV and abdominal fat accumulation reported changes in visceral and liver fat over six months. A later multicenter trial enrolled 61 people with HIV and fatty liver disease; 60 received study treatment. At 12 months, the between-group difference in hepatic fat fraction was 4.1 percentage points in favor of tesamorelin, corresponding to a reported relative effect of 37%.

Percentage points and relative percentages describe the same outcome differently. Neither figure means that body weight fell by that amount. These liver studies concern a defined population and measured outcomes, rather than proof of a general liver treatment or a new approved indication.

Stanley and colleagues in JAMA 2014

Stanley and colleagues in The Lancet HIV 2019

An analysis of integrase inhibitor regimens in 2024

Russo and colleagues analyzed participants using integrase inhibitor-based HIV regimens within the earlier 61-person trial. Thirty-eight were taking these medicines at baseline; 31 completed 12 months. The analysis reported visceral- and liver-fat differences. It is a subgroup analysis of existing trial data, not a separate large trial or evidence for everyone experiencing medication-associated weight change.

Russo and colleagues in AIDS 2024

Approval evidence gaps and research materials

What FDA approval covers

Egrifta WR is approved to reduce excess abdominal fat in adults with HIV and lipodystrophy. Its label states that it is not indicated for weight-loss management and that long-term cardiovascular safety has not been established. The label also states that Egrifta WR and Egrifta SV are not substitutable.

Approval applies to the evaluated prescription product and its labeled conditions. A research preparation does not acquire that status by sharing the ingredient name. Published trials of a pharmaceutical formulation likewise do not authenticate another supplier’s product.

Safety findings are part of the scientific picture

The prescribing information describes elevated IGF-1, fluid retention, glucose intolerance or diabetes, and hypersensitivity among its concerns. Contraindications include active malignancy, disruption of the hypothalamic-pituitary axis, pregnancy, and known hypersensitivity. A growth-hormone-releasing mechanism should not be described as inherently free of risk because it uses an endogenous signaling pathway.

FDA prescribing information including indication limitations and safety information

What the evidence does not settle

Changes in fat distribution or liver-fat measurements do not by themselves establish fewer cardiovascular events, longer life, or improved athletic performance. Short-term average glucose findings also cannot establish that no individual develops a glucose-related problem. The selected trials differ in size, population, and follow-up, and their conclusions should retain those boundaries.

The evidence base includes manufacturer participation in the pivotal development program and disclosed commercial or intellectual-property relationships in later publications. Those relationships do not invalidate results, but they make transparent methods, independent scrutiny, and replication important. The 2024 subgroup paper, for example, discloses consulting relationships and a relevant patent interest.

Research questions involving liver disease should remain separate from the approved lipodystrophy indication. A positive trial, a study registration, and a regulatory approval are different milestones. The published results support specific conclusions in the tested populations, rather than every claim circulating under the peptide’s name.

The closing disclaimer concerns the research product discussed here. It does not negate the separate FDA approval of Egrifta prescription products.

Research and regulatory sources checked October 15, 2026.

Why choose Trace 'Tides?

Because trust starts with real people, clear answers, and quality you can verify. We have a certified peptide specialist on staff, a phone number that connects you with a real human, and a physical location you can visit by appointment. Call or text us—we’re delighted to answer your questions and address your concerns. We also make checkout straightforward by accepting credit cards, without asking you to use cryptocurrency or connect your bank account to an unfamiliar payment app. And every peptide we sell is tested for purity and endotoxins by licensed U.S. laboratories, so you can choose your research peptides with confidence.

DISCLAIMER: These statements are for research purposes only and have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.